SCOPe 2.05: Domain d1vrva_: 1vrv A:

Lineage for d1vrva_ (1vrv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.2: PTS system IIB component-like [52794] (3 families)

5. Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
   Pfam PF02302

6. Protein automated matches [254437] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [254923] (2 PDB entries)

8. Domain d1vrva_: 1vrv A: [240784]
   automated match to d1vkra_

Details for d1vrva_

PDB Entry: 1vrv

PDB Description: structure of phosphorylated iib (c384(sep)) domain of the mannitol- specific permease enzyme ii

PDB Compounds: (A:) mannitol-specific PTS system enzyme IIABC components

SCOPe Domain Sequences for d1vrva_:

Sequence; same for both SEQRES and ATOM records:

>d1vrva_ c.44.2.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh

Timeline for d1vrva_:

• d1vrva_ first appeared in SCOPe 2.04
  
• d1vrva_ appears in SCOPe 2.06
  
• d1vrva_ appears in the current release, SCOPe 2.08