| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) ![]() |
| Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins) Pfam PF02302 |
| Protein automated matches [254437] (1 species) not a true protein |
| Species Escherichia coli [TaxId:83334] [254923] (2 PDB entries) |
| Domain d1vrva_: 1vrv A: [240784] automated match to d1vkra_ |
PDB Entry: 1vrv (more details)
SCOPe Domain Sequences for d1vrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrva_ c.44.2.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh
Timeline for d1vrva_: