Lineage for d1vkra_ (1vkr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599665Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1599779Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1599780Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
    Pfam PF02302
  6. 1599787Protein PTS system mannitol-specific EIICBA component [110596] (1 species)
  7. 1599788Species Escherichia coli [TaxId:562] [110597] (1 PDB entry)
    Uniprot P00550 375-471
  8. 1599789Domain d1vkra_: 1vkr A: [108689]

Details for d1vkra_

PDB Entry: 1vkr (more details)

PDB Description: structure of iib domain of the mannitol-specific permease enzyme ii
PDB Compounds: (A:) mannitol-specific PTS system enzyme IIABC components

SCOPe Domain Sequences for d1vkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]}
shvrkiivacdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh

SCOPe Domain Coordinates for d1vkra_:

Click to download the PDB-style file with coordinates for d1vkra_.
(The format of our PDB-style files is described here.)

Timeline for d1vkra_: