Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
Domain d3s11d_: 3s11 D: [239709] Other proteins in same PDB: d3s11a1, d3s11a2, d3s11c1, d3s11c2, d3s11e1, d3s11e2 automated match to d4n5zb_ complexed with gol, nag, tam |
PDB Entry: 3s11 (more details), 2.5 Å
SCOPe Domain Sequences for d3s11d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s11d_ h.3.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnree
Timeline for d3s11d_: