Lineage for d3s11c1 (3s11 C:11-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776136Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries)
  8. 2776153Domain d3s11c1: 3s11 C:11-323 [185244]
    Other proteins in same PDB: d3s11a2, d3s11b_, d3s11c2, d3s11d_, d3s11e2, d3s11f_
    automated match to d1jsma_
    complexed with gol, nag, tam

Details for d3s11c1

PDB Entry: 3s11 (more details), 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s11c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s11c1 b.19.1.2 (C:11-323) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiipks
swsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnt

SCOPe Domain Coordinates for d3s11c1:

Click to download the PDB-style file with coordinates for d3s11c1.
(The format of our PDB-style files is described here.)

Timeline for d3s11c1: