Lineage for d3s11f_ (3s11 F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041713Domain d3s11f_: 3s11 F: [239710]
    Other proteins in same PDB: d3s11a1, d3s11a2, d3s11c1, d3s11c2, d3s11e1, d3s11e2
    automated match to d4n5zb_
    complexed with gol, nag, tam

Details for d3s11f_

PDB Entry: 3s11 (more details), 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3s11f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s11f_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

SCOPe Domain Coordinates for d3s11f_:

Click to download the PDB-style file with coordinates for d3s11f_.
(The format of our PDB-style files is described here.)

Timeline for d3s11f_: