Lineage for d3s11a1 (3s11 A:11-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040793Species Influenza A virus [TaxId:11320] [187142] (23 PDB entries)
  8. 2040803Domain d3s11a1: 3s11 A:11-323 [185243]
    Other proteins in same PDB: d3s11a2, d3s11b_, d3s11c2, d3s11d_, d3s11e2, d3s11f_
    automated match to d1jsma_
    complexed with gol, nag, tam

Details for d3s11a1

PDB Entry: 3s11 (more details), 2.5 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, strain 437-10
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s11a1 b.19.1.2 (A:11-323) automated matches {Influenza A virus [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiipks
swsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnt

SCOPe Domain Coordinates for d3s11a1:

Click to download the PDB-style file with coordinates for d3s11a1.
(The format of our PDB-style files is described here.)

Timeline for d3s11a1: