SCOPe 2.08: Domain d3i54c2: 3i54 C:145-223

Lineage for d3i54c2 (3i54 C:145-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)

8. Domain d3i54c2: 3i54 C:145-223 [239348]
   Other proteins in same PDB: d3i54a1, d3i54a2, d3i54b1, d3i54b3, d3i54c1, d3i54d1, d3i54d3
   automated match to d3i54b2
   protein/DNA complex; complexed with cmp

Details for d3i54c2

PDB Entry: 3i54, 2.2 Å

PDB Description: crystal structure of mtbcrp in complex with camp

PDB Compounds: (C:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i54c2:

Sequence; same for both SEQRES and ATOM records:

>d3i54c2 a.4.5.0 (C:145-223) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarra

Timeline for d3i54c2:

• d3i54c2 first appeared in SCOPe 2.04
  
• d3i54c2 appears in SCOPe 2.07