Lineage for d3i54d2 (3i54 D:145-223)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694919Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)
  8. 2694932Domain d3i54d2: 3i54 D:145-223 [239350]
    Other proteins in same PDB: d3i54a1, d3i54a2, d3i54b1, d3i54b3, d3i54c1, d3i54d1, d3i54d3
    automated match to d3i54b2
    protein/DNA complex; complexed with cmp

Details for d3i54d2

PDB Entry: 3i54 (more details), 2.2 Å

PDB Description: crystal structure of mtbcrp in complex with camp
PDB Compounds: (D:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i54d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i54d2 a.4.5.0 (D:145-223) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarra

SCOPe Domain Coordinates for d3i54d2:

Click to download the PDB-style file with coordinates for d3i54d2.
(The format of our PDB-style files is described here.)

Timeline for d3i54d2: