SCOP 1.55: Domain d1thw__: 1thw -

Lineage for d1thw__ (1thw -)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family)

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (3 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (4 PDB entries)

8. Domain d1thw__: 1thw - [23903]

Details for d1thw__

PDB Entry: 1thw, 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin

SCOP Domain Sequences for d1thw__:

Sequence; same for both SEQRES and ATOM records:

>d1thw__ b.25.1.1 (-) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d1thw__:

• d1thw__ appears in SCOP 1.57
  
• d1thw__ appears in the current release, SCOPe 2.08, called d1thwa_