Lineage for d1thwa_ (1thw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2777888Protein Thaumatin [49876] (1 species)
  7. 2777889Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries)
    Uniprot P02883
  8. 2777922Domain d1thwa_: 1thw A: [23903]
    complexed with tla

Details for d1thwa_

PDB Entry: 1thw (more details), 1.75 Å

PDB Description: the structures of three crystal forms of the sweet protein thaumatin
PDB Compounds: (A:) thaumatin

SCOPe Domain Sequences for d1thwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thwa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d1thwa_:

Click to download the PDB-style file with coordinates for d1thwa_.
(The format of our PDB-style files is described here.)

Timeline for d1thwa_: