Lineage for d2v5ha_ (2v5h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905458Species Synechococcus elongatus [TaxId:1140] [231303] (1 PDB entry)
  8. 2905459Domain d2v5ha_: 2v5h A: [238874]
    Other proteins in same PDB: d2v5hg_, d2v5hh_, d2v5hi_, d2v5hj_, d2v5hk_, d2v5hl_
    automated match to d2v5hc_
    complexed with cl, gol, na, nlg

Details for d2v5ha_

PDB Entry: 2v5h (more details), 2.75 Å

PDB Description: Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d2v5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5ha_ c.73.1.0 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
kvdccirslaqgvraahiidgriphallleiftdagigtmivgs

SCOPe Domain Coordinates for d2v5ha_:

Click to download the PDB-style file with coordinates for d2v5ha_.
(The format of our PDB-style files is described here.)

Timeline for d2v5ha_: