![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein PII (product of glnB) [54915] (8 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
![]() | Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (4 PDB entries) |
![]() | Domain d2v5hj_: 2v5h J: [168350] Other proteins in same PDB: d2v5ha_, d2v5hb_, d2v5hc_, d2v5hd_, d2v5he_, d2v5hf_ automated match to d1qy7a_ complexed with cl, gol, na, nlg |
PDB Entry: 2v5h (more details), 2.75 Å
SCOPe Domain Sequences for d2v5hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5hj_ d.58.5.1 (J:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknad
Timeline for d2v5hj_: