Lineage for d2v5hl_ (2v5h L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950578Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (4 PDB entries)
  8. 2950591Domain d2v5hl_: 2v5h L: [168352]
    Other proteins in same PDB: d2v5ha_, d2v5hb_, d2v5hc_, d2v5hd_, d2v5he_, d2v5hf_
    automated match to d1qy7a_
    complexed with cl, gol, na, nlg

Details for d2v5hl_

PDB Entry: 2v5h (more details), 2.75 Å

PDB Description: Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942
PDB Compounds: (L:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2v5hl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5hl_ d.58.5.1 (L:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna

SCOPe Domain Coordinates for d2v5hl_:

Click to download the PDB-style file with coordinates for d2v5hl_.
(The format of our PDB-style files is described here.)

Timeline for d2v5hl_: