Lineage for d2v5hi_ (2v5h I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2517842Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 protein domains)
  6. 2517848Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2517856Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (4 PDB entries)
  8. 2517866Domain d2v5hi_: 2v5h I: [168349]
    Other proteins in same PDB: d2v5ha_, d2v5hb_, d2v5hc_, d2v5hd_, d2v5he_, d2v5hf_
    automated match to d1qy7a_
    complexed with cl, gol, na, nlg

Details for d2v5hi_

PDB Entry: 2v5h (more details), 2.75 Å

PDB Description: Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942
PDB Compounds: (I:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2v5hi_:

Sequence, based on SEQRES records: (download)

>d2v5hi_ d.58.5.1 (I:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknada

Sequence, based on observed residues (ATOM records): (download)

>d2v5hi_ d.58.5.1 (I:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkteryrgseytveflqklkle
ivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknada

SCOPe Domain Coordinates for d2v5hi_:

Click to download the PDB-style file with coordinates for d2v5hi_.
(The format of our PDB-style files is described here.)

Timeline for d2v5hi_: