Lineage for d2ooge1 (2oog E:44-309)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448392Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2448393Protein automated matches [190919] (11 species)
    not a true protein
  7. 2448424Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries)
  8. 2448429Domain d2ooge1: 2oog E:44-309 [238777]
    Other proteins in same PDB: d2ooga2, d2oogb2, d2oogc2, d2oogd2, d2ooge2, d2oogf2
    automated match to d2ooga_
    complexed with gol, so4, zn

Details for d2ooge1

PDB Entry: 2oog (more details), 2.2 Å

PDB Description: crystal structure of glycerophosphoryl diester phosphodiesterase from staphylococcus aureus
PDB Compounds: (E:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2ooge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooge1 c.1.18.0 (E:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]}
qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd
etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn
anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv
plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka
dmlrlnkygvdgvftnfadkykevik

SCOPe Domain Coordinates for d2ooge1:

Click to download the PDB-style file with coordinates for d2ooge1.
(The format of our PDB-style files is described here.)

Timeline for d2ooge1: