![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
![]() | Protein automated matches [190919] (11 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries) |
![]() | Domain d2ooge1: 2oog E:44-309 [238777] Other proteins in same PDB: d2ooga2, d2oogb2, d2oogc2, d2oogd2, d2ooge2, d2oogf2 automated match to d2ooga_ complexed with gol, so4, zn |
PDB Entry: 2oog (more details), 2.2 Å
SCOPe Domain Sequences for d2ooge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooge1 c.1.18.0 (E:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]} qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka dmlrlnkygvdgvftnfadkykevik
Timeline for d2ooge1: