SCOPe 2.07: Domain d2oogc1: 2oog C:44-309

Lineage for d2oogc1 (2oog C:44-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries)

8. Domain d2oogc1: 2oog C:44-309 [231092]
   Other proteins in same PDB: d2ooga2, d2oogb2, d2oogc2, d2oogd2, d2ooge2, d2oogf2
   automated match to d3ch0a_
   complexed with gol, so4, zn

Details for d2oogc1

PDB Entry: 2oog, 2.2 Å

PDB Description: crystal structure of glycerophosphoryl diester phosphodiesterase from staphylococcus aureus

PDB Compounds: (C:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2oogc1:

Sequence; same for both SEQRES and ATOM records:

>d2oogc1 c.1.18.0 (C:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]}
qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd
etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn
anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv
plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka
dmlrlnkygvdgvftnfadkykevik

Timeline for d2oogc1:

• d2oogc1 first appeared in SCOPe 2.03, called d2oogc_
  
• d2oogc1 appears in SCOPe 2.06
  
• d2oogc1 appears in the current release, SCOPe 2.08