![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
![]() | Protein automated matches [190919] (10 species) not a true protein |
![]() | Species Cytophaga hutchinsonii [TaxId:269798] [195100] (1 PDB entry) |
![]() | Domain d3ch0a_: 3ch0 A: [195101] automated match to d2pz0b_ complexed with cit, edo, gol |
PDB Entry: 3ch0 (more details), 1.5 Å
SCOPe Domain Sequences for d3ch0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ch0a_ c.1.18.0 (A:) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} gmiqvpasfdiqghrgcrgllpentiaaftkalllgvttlefdlviskdnrvvvshdtff hheitmmvdgedvteaneknfnlyamnyadikeidvgmkthprfksqkkvpavkplfrel ietaeklsakiqyngeikstvegdnidhpnialfcdlvvaeikkahitdrftlqsfdvra leymhsqypdiklsylvetkgtlkkqleklsftpavyspdvtlvskkdidaahklgmrvi pwtvntkeeietlislgvdgiitdypdlffek
Timeline for d3ch0a_: