Lineage for d2pz0b_ (2pz0 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825748Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 1825830Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 1825831Protein automated matches [190919] (10 species)
    not a true protein
  7. 1825873Species Thermoanaerobacter tengcongensis [TaxId:273068] [188407] (1 PDB entry)
  8. 1825875Domain d2pz0b_: 2pz0 B: [167355]
    automated match to d1o1za_
    complexed with ca, gol

Details for d2pz0b_

PDB Entry: 2pz0 (more details), 1.91 Å

PDB Description: Crystal structure of Glycerophosphodiester Phosphodiesterase (GDPD) from T. tengcongensis
PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2pz0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pz0b_ c.1.18.0 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mktlviahrgdsknvpentiaafkramelgadgieldvqltkdghlvvihdetvdrttng
egfvkdftleeikkldagikfgekfageriptlyevfeligdkdflvnieiksgivlypg
ieeklikaikeynfeerviissfnhyslrdvkkmaphlkigllyqcglvepwhmalrmea
yslhpfyfniipelvegckkngvklfpwtvdrkedmermikagvdgiitddpetlinlvr
kgg

SCOPe Domain Coordinates for d2pz0b_:

Click to download the PDB-style file with coordinates for d2pz0b_.
(The format of our PDB-style files is described here.)

Timeline for d2pz0b_: