SCOPe 2.08: Domain d3ch0a1: 3ch0 A:1-271

Lineage for d3ch0a1 (3ch0 A:1-271)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [195100] (1 PDB entry)

8. Domain d3ch0a1: 3ch0 A:1-271 [195101]
   Other proteins in same PDB: d3ch0a2
   automated match to d2pz0b_
   complexed with cit, edo, gol

Details for d3ch0a1

PDB Entry: 3ch0, 1.5 Å

PDB Description: crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution

PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d3ch0a1:

Sequence; same for both SEQRES and ATOM records:

>d3ch0a1 c.1.18.0 (A:1-271) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miqvpasfdiqghrgcrgllpentiaaftkalllgvttlefdlviskdnrvvvshdtffh
heitmmvdgedvteaneknfnlyamnyadikeidvgmkthprfksqkkvpavkplfreli
etaeklsakiqyngeikstvegdnidhpnialfcdlvvaeikkahitdrftlqsfdvral
eymhsqypdiklsylvetkgtlkkqleklsftpavyspdvtlvskkdidaahklgmrvip
wtvntkeeietlislgvdgiitdypdlffek

Timeline for d3ch0a1:

• d3ch0a1 first appeared in SCOPe 2.02, called d3ch0a_
  
• d3ch0a1 appears in SCOPe 2.07