PDB entry 3ch0

View 3ch0 on RCSB PDB site
Description: Crystal structure of glycerophosphoryl diester phosphodiesterase (YP_677622.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
Class: hydrolase
Keywords: YP_677622.1, glycerophosphoryl diester phosphodiesterase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Hydrolase
Deposited on 2008-03-06, released 2008-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glycerophosphodiester phosphodiesterase
  Species: Cytophaga hutchinsonii ATCC 33406 [TaxId:269798]
  Gene: YP_677622.1, ugpQ, CHU_1005
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q11WD4 (1-271)
    • leader sequence (0)
  Domains in SCOPe 2.05: d3ch0a_
• Heterogens: CIT, EDO, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ch0A (A:)
  gmiqvpasfdiqghrgcrgllpentiaaftkalllgvttlefdlviskdnrvvvshdtff
  hheitmmvdgedvteaneknfnlyamnyadikeidvgmkthprfksqkkvpavkplfrel
  ietaeklsakiqyngeikstvegdnidhpnialfcdlvvaeikkahitdrftlqsfdvra
  leymhsqypdiklsylvetkgtlkkqleklsftpavyspdvtlvskkdidaahklgmrvi
  pwtvntkeeietlislgvdgiitdypdlffek