Lineage for d2ooga_ (2oog A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825748Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 1825830Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 1825831Protein automated matches [190919] (10 species)
    not a true protein
  7. 1825858Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries)
  8. 1825859Domain d2ooga_: 2oog A: [231090]
    automated match to d3ch0a_
    complexed with gol, so4, zn

Details for d2ooga_

PDB Entry: 2oog (more details), 2.2 Å

PDB Description: crystal structure of glycerophosphoryl diester phosphodiesterase from staphylococcus aureus
PDB Compounds: (A:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2ooga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooga_ c.1.18.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd
etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn
anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv
plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka
dmlrlnkygvdgvftnfadkykevike

SCOPe Domain Coordinates for d2ooga_:

Click to download the PDB-style file with coordinates for d2ooga_.
(The format of our PDB-style files is described here.)

Timeline for d2ooga_: