SCOPe 2.08: Domain d2jj2a2: 2jj2 A:95-379

Lineage for d2jj2a2 (2jj2 A:95-379)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (12 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255271] (6 PDB entries)

8. Domain d2jj2a2: 2jj2 A:95-379 [238741]
   Other proteins in same PDB: d2jj2a1, d2jj2a3, d2jj2b1, d2jj2b3, d2jj2c1, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h3, d2jj2i1, d2jj2i3, d2jj2j1, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_
   automated match to d1maba3
   complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2a2

PDB Entry: 2jj2, 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.

PDB Compounds: (A:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj2a2:

Sequence; same for both SEQRES and ATOM records:

>d2jj2a2 c.37.1.11 (A:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

Timeline for d2jj2a2:

• d2jj2a2 first appeared in SCOPe 2.04
  
• d2jj2a2 appears in SCOPe 2.07