SCOPe 2.08: Domain d2jj2g_: 2jj2 G:

Lineage for d2jj2g_ (2jj2 G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
   automatically mapped to Pfam PF00231

6. Protein F1 ATP synthase gamma subunit [52945] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
   Uniprot P05631

8. Domain d2jj2g_: 2jj2 G: [148125]
   Other proteins in same PDB: d2jj2a1, d2jj2a2, d2jj2a3, d2jj2b1, d2jj2b2, d2jj2b3, d2jj2c1, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2h1, d2jj2h2, d2jj2h3, d2jj2i1, d2jj2i2, d2jj2i3, d2jj2j1, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3
   automated match to d1bmfg_
   complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2g_

PDB Entry: 2jj2, 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.

PDB Compounds: (G:) ATP synthase gamma chain

SCOPe Domain Sequences for d2jj2g_:

Sequence, based on SEQRES records:

>d2jj2g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records):

>d2jj2g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal

Timeline for d2jj2g_:

• d2jj2g_ first appeared in SCOP 1.75, called d2jj2g1
  
• d2jj2g_ appears in SCOPe 2.07