Lineage for d2jj2a1 (2jj2 A:24-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798867Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)
  8. 2798877Domain d2jj2a1: 2jj2 A:24-94 [238740]
    Other proteins in same PDB: d2jj2a2, d2jj2a3, d2jj2b2, d2jj2b3, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h2, d2jj2h3, d2jj2i2, d2jj2i3, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_
    automated match to d1maba2
    complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2a1

PDB Entry: 2jj2 (more details), 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.
PDB Compounds: (A:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj2a1 b.49.1.0 (A:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d2jj2a1:

Click to download the PDB-style file with coordinates for d2jj2a1.
(The format of our PDB-style files is described here.)

Timeline for d2jj2a1: