Lineage for d1qiue1 (1qiu E:396-582)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776942Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries)
  8. 2776948Domain d1qiue1: 1qiu E:396-582 [23847]
    Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2

Details for d1qiue1

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres
PDB Compounds: (E:) adenovirus fibre

SCOPe Domain Sequences for d1qiue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiue1 b.21.1.1 (E:396-582) Adenovirus fiber protein 'knob' domain {Human adenovirus type 2 [TaxId: 10515]}
ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv
siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn
ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt
fsyiaqe

SCOPe Domain Coordinates for d1qiue1:

Click to download the PDB-style file with coordinates for d1qiue1.
(The format of our PDB-style files is described here.)

Timeline for d1qiue1: