| Class b: All beta proteins [48724] (180 folds) |
| Fold b.83: Triple beta-spiral [51224] (1 superfamily) trimer formed by the interlocking beta-hairpin repeat units |
Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) ![]() |
| Family b.83.1.1: Adenovirus [51226] (1 protein) |
| Protein Adenovirus [51227] (1 species) |
| Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries) Uniprot P10104 |
| Domain d1qiue2: 1qiu E:319-395 [28212] Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1 |
PDB Entry: 1qiu (more details), 2.4 Å
SCOPe Domain Sequences for d1qiue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qiue2 b.83.1.1 (E:319-395) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn
Timeline for d1qiue2: