SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qiuf2 (1qiu F:319-395)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2071972Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 2071973Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) (S)
  5. 2071974Family b.83.1.1: Adenovirus [51226] (1 protein)
  6. 2071975Protein Adenovirus [51227] (1 species)
  7. 2071976Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
    Uniprot P10104
  8. 2071991Domain d1qiuf2: 1qiu F:319-395 [28213]
    Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiuf2

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres
PDB Compounds: (F:) adenovirus fibre

SCOPe Domain Sequences for d1qiuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiuf2 b.83.1.1 (F:319-395) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

SCOPe Domain Coordinates for d1qiuf2:

Click to download the PDB-style file with coordinates for d1qiuf2.
(The format of our PDB-style files is described here.)

Timeline for d1qiuf2: