PDB entry 1qiu

View 1qiu on RCSB PDB site
Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres
Class: fibre protein
Keywords: fibre protein, triple beta-spiral, adenovirus
Deposited on 1999-06-16, released 1999-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiua1, d1qiua2
  • Chain 'B':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiub1, d1qiub2
  • Chain 'C':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiuc1, d1qiuc2
  • Chain 'D':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiud1, d1qiud2
  • Chain 'E':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiue1, d1qiue2
  • Chain 'F':
    Compound: adenovirus fibre
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: LOCUS AD2H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qiuf1, d1qiuf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuA (A:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuB (B:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuC (C:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuD (D:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuE (E:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qiuF (F:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaa
    lavsgdlssmtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfm
    pnllaypktqsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftws
    wesgkyttetfatnsytfsyiaqe