Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species) |
Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries) Uniprot Q868M7 11-442 |
Domain d3w9tf1: 3w9t F:2-150 [237910] Other proteins in same PDB: d3w9ta3, d3w9ta4, d3w9tb3, d3w9tb4, d3w9tc3, d3w9tc4, d3w9td3, d3w9td4, d3w9te3, d3w9te4, d3w9tf3, d3w9tf4, d3w9tg3, d3w9tg4 automated match to d1vcla1 complexed with ca, mg |
PDB Entry: 3w9t (more details), 2.9 Å
SCOPe Domain Sequences for d3w9tf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w9tf1 b.42.2.1 (F:2-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} vlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearny cftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcld iegsdgtgdigvydcqnlddqyfyvrsrg
Timeline for d3w9tf1: