![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species) |
![]() | Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries) Uniprot Q868M7 11-442 |
![]() | Domain d3w9tb2: 3w9t B:151-283 [237905] Other proteins in same PDB: d3w9ta3, d3w9ta4, d3w9tb3, d3w9tb4, d3w9tc3, d3w9tc4, d3w9td3, d3w9td4, d3w9te3, d3w9te4, d3w9tf3, d3w9tf4, d3w9tg3, d3w9tg4 automated match to d1vcla2 complexed with ca, mg |
PDB Entry: 3w9t (more details), 2.9 Å
SCOPe Domain Sequences for d3w9tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w9tb2 b.42.2.1 (B:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} pelfygrlrneksdlcldvegsdgkgnvlmyscednldqwfryyengeivnaksgmcldv egsdgsgnvgiyrcddlrdqmwsrpnaycngdycsflnkesnkcldvsgdqgtgdvgtwq cdglpdqrfkwvf
Timeline for d3w9tb2: