Lineage for d3w9td3 (3w9t D:284-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009628Fold d.281: Hemolytic lectin CEL-III, C-terminal domain [111264] (1 superfamily)
    unusual fold
  4. 3009629Superfamily d.281.1: Hemolytic lectin CEL-III, C-terminal domain [111265] (1 family) (S)
  5. 3009630Family d.281.1.1: Hemolytic lectin CEL-III, C-terminal domain [111266] (1 protein)
  6. 3009631Protein Hemolytic lectin CEL-III, C-terminal domain [111267] (1 species)
  7. 3009632Species Cucumaria echinata [TaxId:40245] [111268] (4 PDB entries)
    Uniprot Q868M7 11-442
  8. 3009642Domain d3w9td3: 3w9t D:284-432 [237897]
    Other proteins in same PDB: d3w9ta1, d3w9ta2, d3w9ta4, d3w9tb1, d3w9tb2, d3w9tb4, d3w9tc1, d3w9tc2, d3w9tc4, d3w9td1, d3w9td2, d3w9td4, d3w9te1, d3w9te2, d3w9te4, d3w9tf1, d3w9tf2, d3w9tf4, d3w9tg1, d3w9tg2, d3w9tg4
    automated match to d1vcla3
    complexed with ca, mg

Details for d3w9td3

PDB Entry: 3w9t (more details), 2.9 Å

PDB Description: pore-forming cel-iii
PDB Compounds: (D:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d3w9td3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w9td3 d.281.1.1 (D:284-432) Hemolytic lectin CEL-III, C-terminal domain {Cucumaria echinata [TaxId: 40245]}
ddwevptatwnmvgcdqngkvsqqisntisfsstvtagvavevsstiekgvifakatvsv
kvtaslskawtnsqsgttaitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqi
vkctrsntapgcapftkcanedctfctdi

SCOPe Domain Coordinates for d3w9td3:

Click to download the PDB-style file with coordinates for d3w9td3.
(The format of our PDB-style files is described here.)

Timeline for d3w9td3: