Lineage for d1ghoo3 (1gho O:3-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12089Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 12090Protein beta-Galactosidase [49804] (1 species)
  7. 12091Species Escherichia coli [TaxId:562] [49805] (7 PDB entries)
  8. 12126Domain d1ghoo3: 1gho O:3-219 [23756]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop4, d1ghop5

Details for d1ghoo3

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1ghoo3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghoo3 b.18.1.5 (O:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1ghoo3:

Click to download the PDB-style file with coordinates for d1ghoo3.
(The format of our PDB-style files is described here.)

Timeline for d1ghoo3: