Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) |
Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) |
Family c.1.8.3: beta-glycanases [51487] (12 proteins) |
Protein beta-Galactosidase, domain 3 [51510] (1 species) |
Species Escherichia coli [TaxId:562] [51511] (7 PDB entries) |
Domain d1ghop5: 1gho P:334-625 [28880] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghop1, d1ghop2, d1ghop3, d1ghop4 |
PDB Entry: 1gho (more details), 2.5 Å
SCOP Domain Sequences for d1ghop5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghop5 c.1.8.3 (P:334-625) beta-Galactosidase, domain 3 {Escherichia coli} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1ghop5:
View in 3D Domains from same chain: (mouse over for more information) d1ghop1, d1ghop2, d1ghop3, d1ghop4 |
View in 3D Domains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghoo5 |