SCOPe 2.08: Domain d4l2da2: 4l2d A:83-192

Lineage for d4l2da2 (4l2d A:83-192)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries)

8. Domain d4l2da2: 4l2d A:83-192 [237189]
   Other proteins in same PDB: d4l2da1, d4l2db1, d4l2dc1, d4l2dd1
   automated match to d3lioa2
   complexed with fe2

Details for d4l2da2

PDB Entry: 4l2d, 2.07 Å

PDB Description: x-ray structure of the fe(ii) form of the iron superoxide dismutase from pseudoalteromonas haloplanktis

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2da2:

Sequence; same for both SEQRES and ATOM records:

>d4l2da2 d.44.1.0 (A:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

Timeline for d4l2da2:

• d4l2da2 first appeared in SCOPe 2.03
  
• d4l2da2 appears in SCOPe 2.07