PDB entry 4l2d

View 4l2d on RCSB PDB site
Description: X-ray structure of the Fe(II) form of the iron superoxide dismutase from Pseudoalteromonas haloplanktis
Class: oxidoreductase
Keywords: Superoxide dismutase, OXIDOREDUCTASE
Deposited on 2013-06-04, released 2014-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2da1, d4l2da2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2db1, d4l2db2
  • Chain 'C':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2dc1, d4l2dc2
  • Chain 'D':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l2dd1, d4l2dd2
  • Heterogens: FE2, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2dA (A:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2dB (B:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2dC (C:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2dD (D:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa