| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (38 species) not a true protein |
| Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries) |
| Domain d4l2dd2: 4l2d D:83-192 [237193] Other proteins in same PDB: d4l2da1, d4l2db1, d4l2dc1, d4l2dd1 automated match to d3lioa2 complexed with fe2 |
PDB Entry: 4l2d (more details), 2.07 Å
SCOPe Domain Sequences for d4l2dd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2dd2 d.44.1.0 (D:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d4l2dd2: