Lineage for d4l2dd2 (4l2d D:83-192)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (34 species)
    not a true protein
  7. 2514138Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries)
  8. 2514150Domain d4l2dd2: 4l2d D:83-192 [237193]
    Other proteins in same PDB: d4l2da1, d4l2db1, d4l2dc1, d4l2dd1
    automated match to d3lioa2
    complexed with fe2, tre

Details for d4l2dd2

PDB Entry: 4l2d (more details), 2.07 Å

PDB Description: X-ray structure of the Fe(II) form of the iron superoxide dismutase from Pseudoalteromonas haloplanktis
PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2dd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2dd2 d.44.1.0 (D:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

SCOPe Domain Coordinates for d4l2dd2:

Click to download the PDB-style file with coordinates for d4l2dd2.
(The format of our PDB-style files is described here.)

Timeline for d4l2dd2: