![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries) |
![]() | Domain d4l2dc2: 4l2d C:83-192 [237191] Other proteins in same PDB: d4l2da1, d4l2db1, d4l2dc1, d4l2dd1 automated match to d3lioa2 complexed with fe2 |
PDB Entry: 4l2d (more details), 2.07 Å
SCOPe Domain Sequences for d4l2dc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2dc2 d.44.1.0 (C:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]} ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d4l2dc2: