SCOPe 2.08: Domain d4l2dc1: 4l2d C:1-82

Lineage for d4l2dc1 (4l2d C:1-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)

8. Domain d4l2dc1: 4l2d C:1-82 [237190]
   Other proteins in same PDB: d4l2da2, d4l2db2, d4l2dc2, d4l2dd2
   automated match to d3lioa1
   complexed with fe2

Details for d4l2dc1

PDB Entry: 4l2d, 2.07 Å

PDB Description: x-ray structure of the fe(ii) form of the iron superoxide dismutase from pseudoalteromonas haloplanktis

PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2dc1:

Sequence; same for both SEQRES and ATOM records:

>d4l2dc1 a.2.11.0 (C:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

Timeline for d4l2dc1:

• d4l2dc1 first appeared in SCOPe 2.03
  
• d4l2dc1 appears in SCOPe 2.07