SCOPe 2.08: Domain d4cq1f1: 4cq1 F:337-444

Lineage for d4cq1f1 (4cq1 F:337-444)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d4cq1f1: 4cq1 F:337-444 [236986]
   Other proteins in same PDB: d4cq1a2, d4cq1b2, d4cq1c2, d4cq1d2, d4cq1e2, d4cq1f2, d4cq1g2, d4cq1h2
   automated match to d4ckob1
   complexed with cl, zn

Details for d4cq1f1

PDB Entry: 4cq1, 1.69 Å

PDB Description: crystal structure of the neuronal isoform of ptb

PDB Compounds: (F:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4cq1f1:

Sequence, based on SEQRES records:

>d4cq1f1 d.58.7.1 (F:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records):

>d4cq1f1 d.58.7.1 (F:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgs

Timeline for d4cq1f1:

• d4cq1f1 first appeared in SCOPe 2.03
  
• d4cq1f1 appears in SCOPe 2.07