Lineage for d4cq1e2 (4cq1 E:445-531)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952548Domain d4cq1e2: 4cq1 E:445-531 [237004]
    Other proteins in same PDB: d4cq1a1, d4cq1b1, d4cq1c1, d4cq1d1, d4cq1e1, d4cq1f1, d4cq1g1, d4cq1h1
    automated match to d4ckob2
    complexed with cl, zn

Details for d4cq1e2

PDB Entry: 4cq1 (more details), 1.69 Å

PDB Description: crystal structure of the neuronal isoform of ptb
PDB Compounds: (E:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4cq1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cq1e2 d.58.7.0 (E:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d4cq1e2:

Click to download the PDB-style file with coordinates for d4cq1e2.
(The format of our PDB-style files is described here.)

Timeline for d4cq1e2: