Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
Domain d4cq1d2: 4cq1 D:445-531 [237005] Other proteins in same PDB: d4cq1a1, d4cq1b1, d4cq1c1, d4cq1d1, d4cq1e1, d4cq1f1, d4cq1g1, d4cq1h1 automated match to d4ckob2 complexed with cl, zn |
PDB Entry: 4cq1 (more details), 1.69 Å
SCOPe Domain Sequences for d4cq1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cq1d2 d.58.7.0 (D:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]} knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea iqalidlhnynlgenhhlrvsfsksti
Timeline for d4cq1d2: