SCOPe 2.04: Domain d3upda1: 3upd A:-22-152

Lineage for d3upda1 (3upd A:-22-152)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)

8. Domain d3upda1: 3upd A:-22-152 [233801]
   automated match to d4jfrb1

Details for d3upda1

PDB Entry: 3upd, 2.91 Å

PDB Description: 2.9 angstrom crystal structure of ornithine carbamoyltransferase (argf) from vibrio vulnificus

PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3upda1:

Sequence, based on SEQRES records:

>d3upda1 c.78.1.0 (A:-22-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
hhhhhhssgvdlgtenlyfqsnamafnlrnrnflklldfstkeiqflidlsadlkkakya
gteqkkllgknialifekastrtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarv
lgrmydgiqyrgfgqaiveelgafagvpvwngltdefhptqiladfltmlehsqg

Sequence, based on observed residues (ATOM records):

>d3upda1 c.78.1.0 (A:-22-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
hhhhhhyfqsnamafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgkn
ialifekastrtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyr
gfgqaiveelgafagvpvwngltdefhptqiladfltmlehsqg

Timeline for d3upda1:

• d3upda1 first appeared in SCOPe 2.03
  
• d3upda1 appears in SCOPe 2.05
  
• d3upda1 appears in the current release, SCOPe 2.08