![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries) |
![]() | Domain d3upda1: 3upd A:-5-152 [233801] Other proteins in same PDB: d3upda3 automated match to d4jfrb1 |
PDB Entry: 3upd (more details), 2.91 Å
SCOPe Domain Sequences for d3upda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3upda1 c.78.1.0 (A:-5-152) automated matches {Vibrio vulnificus [TaxId: 216895]} yfqsnamafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialife kastrtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqai veelgafagvpvwngltdefhptqiladfltmlehsqg
Timeline for d3upda1: