Lineage for d3sr6l2 (3sr6 L:695-1315)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670288Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1670289Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1670290Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1670374Protein automated matches [230468] (2 species)
    not a true protein
  7. 1670375Species Cow (Bos taurus) [TaxId:9913] [232097] (9 PDB entries)
  8. 1670387Domain d3sr6l2: 3sr6 L:695-1315 [233616]
    Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c1, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l1
    automated match to d1v97a5
    complexed with fad, fes, mte, rmo

Details for d3sr6l2

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6l2 d.133.1.1 (L:695-1315) automated matches {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkftt

SCOPe Domain Coordinates for d3sr6l2:

Click to download the PDB-style file with coordinates for d3sr6l2.
(The format of our PDB-style files is described here.)

Timeline for d3sr6l2: