Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops |
Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) duplication: consists of 4 structural repeats arranged in 2 lobes contains one left-hand beta-alpha-beta unit per lobe automatically mapped to Pfam PF02738 |
Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins) |
Protein automated matches [230468] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232097] (9 PDB entries) |
Domain d3sr6l2: 3sr6 L:695-1315 [233616] Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c1, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l1 automated match to d1v97a5 complexed with fad, fes, mte, rmo |
PDB Entry: 3sr6 (more details), 2.1 Å
SCOPe Domain Sequences for d3sr6l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr6l2 d.133.1.1 (L:695-1315) automated matches {Cow (Bos taurus) [TaxId: 9913]} iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf rldspatpekirnacvdkftt
Timeline for d3sr6l2: