Lineage for d3sr6l1 (3sr6 L:571-694)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647037Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1647122Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 1647123Protein automated matches [230465] (2 species)
    not a true protein
  7. 1647124Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries)
  8. 1647136Domain d3sr6l1: 3sr6 L:571-694 [233615]
    Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l2
    automated match to d1v97a3
    complexed with fad, fes, mte, rmo

Details for d3sr6l1

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6l1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3sr6l1:

Click to download the PDB-style file with coordinates for d3sr6l1.
(The format of our PDB-style files is described here.)

Timeline for d3sr6l1: