Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
Domain d3sr6b2: 3sr6 B:415-528 [239754] Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6c1, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6l1, d3sr6l2 automated match to d3eub32 complexed with fad, fes, mte, rmo |
PDB Entry: 3sr6 (more details), 2.1 Å
SCOPe Domain Sequences for d3sr6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr6b2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3sr6b2: