SCOPe 2.08: Domain d3ru4b_: 3ru4 B:

Lineage for d3ru4b_ (3ru4 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein automated matches [192457] (4 species)
   not a true protein

7. Species Cowpea (Vigna unguiculata) [TaxId:3917] [192448] (2 PDB entries)

8. Domain d3ru4b_: 3ru4 B: [233503]
   Other proteins in same PDB: d3ru4t_
   automated match to d1bbia_
   complexed with ca, edo, gol, mrd, so4

Details for d3ru4b_

PDB Entry: 3ru4, 1.68 Å

PDB Description: Crystal structure of the Bowman-Birk serine protease inhibitor BTCI in complex with trypsin and chymotrypsin

PDB Compounds: (B:) Bowman-Birk type seed trypsin and chymotrypsin inhibitor

SCOPe Domain Sequences for d3ru4b_:

Sequence; same for both SEQRES and ATOM records:

>d3ru4b_ g.3.13.1 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
sskpccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpck
s

Timeline for d3ru4b_:

• d3ru4b_ first appeared in SCOPe 2.03
  
• d3ru4b_ appears in SCOPe 2.07