Lineage for d3ru4b_ (3ru4 B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1460483Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1460484Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1460512Protein automated matches [192457] (2 species)
    not a true protein
  7. 1460513Species Cowpea (Vigna unguiculata) [TaxId:3917] [192448] (2 PDB entries)
  8. 1460514Domain d3ru4b_: 3ru4 B: [233503]
    Other proteins in same PDB: d3ru4t_
    automated match to d1bbia_
    complexed with ca, edo, gol, mrd, so4

Details for d3ru4b_

PDB Entry: 3ru4 (more details), 1.68 Å

PDB Description: Crystal structure of the Bowman-Birk serine protease inhibitor BTCI in complex with trypsin and chymotrypsin
PDB Compounds: (B:) Bowman-Birk type seed trypsin and chymotrypsin inhibitor

SCOPe Domain Sequences for d3ru4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ru4b_ g.3.13.1 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
sskpccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpck
s

SCOPe Domain Coordinates for d3ru4b_:

Click to download the PDB-style file with coordinates for d3ru4b_.
(The format of our PDB-style files is described here.)

Timeline for d3ru4b_: