PDB entry 3ru4
View 3ru4 on RCSB PDB site
Description: Crystal structure of the Bowman-Birk serine protease inhibitor BTCI in complex with trypsin and chymotrypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease and bowman-birk fold, digestion and inhibition, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-05-04, released
2012-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-08-29, with a file datestamp of
2012-08-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.159
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'B':
Compound: Bowman-Birk type seed trypsin and chymotrypsin inhibitor
Species: Vigna unguiculata [TaxId:3917]
Database cross-references and differences (RAF-indexed):
- Uniprot P17734 (0-60)
- conflict (6-7)
- conflict (9)
- conflict (22)
Domains in SCOPe 2.08: d3ru4b_ - Chain 'C':
Compound: chymotrypsinogen a
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: chymotrypsinogen a
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: chymotrypsinogen a
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ru4t_ - Heterogens: CA, GOL, SO4, EDO, MRD, HOH
PDB Chain Sequences:
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ru4B (B:)
sskpccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpck
s
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'T':
Sequence; same for both SEQRES and ATOM records: (download)
>3ru4T (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn