PDB entry 3ru4

View 3ru4 on RCSB PDB site
Description: Crystal structure of the Bowman-Birk serine protease inhibitor BTCI in complex with trypsin and chymotrypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease and bowman-birk fold, digestion and inhibition, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-05-04, released 2012-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.159
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Bowman-Birk type seed trypsin and chymotrypsin inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17734 (0-60)
      • conflict (6-7)
      • conflict (9)
      • conflict (22)
    Domains in SCOPe 2.08: d3ru4b_
  • Chain 'C':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ru4t_
  • Heterogens: CA, GOL, SO4, EDO, MRD, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ru4B (B:)
sskpccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpck
s

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ru4T (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn